PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00017906-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 223aa    MW: 25070.1 Da    PI: 4.6174
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00017906-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.63.9e-105491847
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      E e++v  v    ++ W++Ia++++ gRt++++k++w+++
  PSME_00017906-RA 54 EKEKIVVMVGDVDMR-WALIASKLP-GRTDNEIKNYWNTH 91
                      777788888888888.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.2774196IPR017930Myb domain
SMARTSM007172.0E-44594IPR001005SANT/Myb domain
SuperFamilySSF466891.25E-854100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-145493IPR009057Homeodomain-like
CDDcd001671.00E-75492No hitNo description
PfamPF002491.3E-75491IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MNDDDVDDMN LFDPEETKAS GTNIDVEEIL VSQFPPVTQL GIEERDVCWG NIMEKEKIVV  60
MVGDVDMRWA LIASKLPGRT DNEIKNYWNT HVKRKMLQRG VDPYTHLSLK PHHGIFESSS  120
EINLLPKRGC KPNELLTDFF QQQSSVQKVY SSIHDNADDK DVNLELSISL PFLCTEQGAS  180
SNSNEFSSRI KPSNDCIQHD HKEEICCHIG LQTVGGSCCS GSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35515.17e-19high response to osmotic stress 10